PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV40512.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family WOX
Protein Properties Length: 376aa    MW: 41694.1 Da    PI: 7.2616
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV40512.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.81.6e-1752112257
                 T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                 ++R+++ +eq+++Le+ F++   +p ++e++++ ++l    ++ +++V++WFqNr+ + k+
  KZV40512.1  52 KPRWNPRPEQIRILEAIFNSgMVNPPRDEIRKIRAQLqeygQVGDANVFYWFQNRKSRSKH 112
                 89*****************99*************************************995 PP

2Wus_type_Homeobox111.83.6e-3651114265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +++RW+P+peQi+iLe++++sG+++P+++ei++i+a+L+eyG+++d+NVfyWFQNrk+R+++kq
         KZV40512.1  51 PKPRWNPRPEQIRILEAIFNSGMVNPPRDEIRKIRAQLQEYGQVGDANVFYWFQNRKSRSKHKQ 114
                        689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.18748113IPR001356Homeobox domain
SuperFamilySSF466895.99E-1250117IPR009057Homeodomain-like
SMARTSM003899.5E-950117IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.3E-751117IPR009057Homeodomain-like
CDDcd000863.52E-851114No hitNo description
PfamPF000463.8E-1552112IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPCNTT HLQWQQHDLA AGYHRTPYTP VPGCEERTLE PKPRWNPRPE  60
QIRILEAIFN SGMVNPPRDE IRKIRAQLQE YGQVGDANVF YWFQNRKSRS KHKQRQLSNT  120
TKSQPQPTAP PPPISNVVTT TVTVPTTSSS SSDKTSPNCS AEKALSVGST PVIDLLNSPT  180
ASVNQPFLQA PRELLSEHFF FPLQQNTGGS TAAPPLTQGF CFPDLSTVID QGIENFPSYP  240
LGELMLMNNS VIRKAQDDKI RLQQEINHSI AAATNSTVPT IFTPCLGITC PTDCILQGEM  300
VPAKSTVFIN DVCLEVGSGP FNVREAFGND AVLVQSSGQP VITNEWGVTV QPLHHGEFYY  360
LLRAFTPDES RTIHLI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096377.11e-166PREDICTED: WUSCHEL-related homeobox 9
RefseqXP_011096378.11e-166PREDICTED: WUSCHEL-related homeobox 9
RefseqXP_011096379.11e-166PREDICTED: WUSCHEL-related homeobox 9
RefseqXP_011096381.11e-166PREDICTED: WUSCHEL-related homeobox 9
TrEMBLA0A061GG541e-134A0A061GG54_THECC; Homeobox-3, putative
STRINGVIT_10s0003g00560.t011e-125(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA59422335
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.16e-55homeobox-3